ADAM9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004000

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004000 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

142 

Antigen sequence

PCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNC
GFSGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGV
DFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCD
 

Matching transcripts

ADAM9-001 - ENSP00000419446 [100%]
ADAM9-005 - ENSP00000418437 [100%]
ADAM9-007 - ENSP00000369249 [100%]
ADAM9-006 - ENSP00000418737 [87%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:15 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

90.6, 78.5, 72.4, 69.3 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ADAM9-001
 
ADAM9-005
 
ADAM9-006
 
ADAM9-007