NPNT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003711

 

Antibody HPA050203

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003711 HPA050203 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

138 159 

Antigen sequence

RQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYN
VRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGN
NNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPK
 
TVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVL
VHSCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARL
VLPLGRLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGAHGAALWGRNGGH
GWRQTQITL
 

Matching transcripts

NPNT-001 - ENSP00000369323 [99%]
NPNT-002 - ENSP00000402884 [99%]
NPNT-003 - ENSP00000389252 [99%]
NPNT-004 - ENSP00000422044 [99%]
NPNT-005 - ENSP00000302557 [99%]
NPNT-006 - ENSP00000422474 [99%]
NPNT-008 - ENSP00000427507 [99%]
NPNT-009 - ENSP00000426146 [99%]
 NPNT-001 - ENSP00000369323 [100%]
NPNT-002 - ENSP00000402884 [100%]
NPNT-003 - ENSP00000389252 [100%]
NPNT-009 - ENSP00000426146 [100%]
NPNT-004 - ENSP00000422044 [81%]
NPNT-005 - ENSP00000302557 [81%]
NPNT-006 - ENSP00000422474 [81%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in goblet cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:25  

Literature conformity

No avaliable characterization data  

RNA consistency

Mainly not consistent with RNAseq data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

66.9, 65.2, 64.0, 62.0, 61.9, 58.7, 55.7, 49.8 66.9, 65.2, 64.0, 62.0, 61.9, 58.7, 55.7 

Antibody dilution

1:250 1:170 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:1350 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus & cytoplasm.
More information
 

Antibody dilution

 1:34 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
NPNT-001
 
NPNT-002
 
NPNT-003
 
NPNT-004
 
NPNT-005
 
NPNT-006
 
NPNT-008
 
NPNT-009