SIN3A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047213

 

Antibody CAB004506

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA047213 sc-5299 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

116  

Antigen sequence

SDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQR
GREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYR
RTALLRAHQSHERVSK
 
 

Matching transcripts

SIN3A-001 - ENSP00000378402 [100%]
SIN3A-002 - ENSP00000353622 [100%]
SIN3A-004 - ENSP00000378403 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:20 

Validation IH

 Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HeLa shows positivity in cytoplasm, cytokinetic bridge & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:75 1:5 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

145.2 145.2, 19.3, 17.1, 15.4, 14.0, 13.2, 11.4, 10.5, 2.2 

Antibody dilution

1:380 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
SIN3A-001
 
SIN3A-002
 
SIN3A-004