PTK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001842

 

Antibody HPA029671

 

Antibody CAB004036

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Cell Signaling Technology, Inc
 

Product name

HPA001842 HPA029671 3285 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 6 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

145 106  

Antigen sequence

PEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPE
PLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPK
LANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
 
MADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAV
SVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQG
IYMSPE
 
 

Matching transcripts

PTK2-001 - ENSP00000429911 [100%]
PTK2-003 - ENSP00000429023 [100%]
PTK2-007 - ENSP00000429129 [100%]
PTK2-008 - ENSP00000429082 [100%]
PTK2-010 - ENSP00000429929 [100%]
PTK2-011 - ENSP00000341189 [100%]
PTK2-057 - ENSP00000429474 [100%]
PTK2-201 - ENSP00000378644 [100%]
PTK2-202 - ENSP00000438009 [100%]
 PTK2-001 - ENSP00000429911 [100%]
PTK2-003 - ENSP00000429023 [100%]
PTK2-007 - ENSP00000429129 [100%]
PTK2-008 - ENSP00000429082 [100%]
PTK2-010 - ENSP00000429929 [100%]
PTK2-011 - ENSP00000341189 [100%]
PTK2-057 - ENSP00000429474 [100%]
PTK2-201 - ENSP00000378644 [100%]
PTK2-202 - ENSP00000438009 [100%]
PTK2-052 - ENSP00000428593 [94%]
PTK2-002 - ENSP00000428492 [93%]
PTK2-203 - ENSP00000445742 [93%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:50  1:10 

Literature conformity

Partly consistent with extensive gene/protein characterization data  Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data  Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & focal adhesion sites.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles & focal adhesion sites.
More information
 Application not done for this antibody. 

Antibody dilution

1:14 1:50  

Validation IF

Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Testis
More information
 

Target mass (kDa)

124.1, 120.9, 120.8, 119.2, 115.4, 114.3, 35.8 124.1, 120.9, 120.8, 119.2, 115.4, 114.3, 81.5, 81.0, 35.8, 14.3 124.1, 120.9, 120.8, 119.2, 115.4, 114.3, 84.8, 81.5, 81.0, 76.8, 40.2, 35.8, 19.3, 18.2, 15.0, 14.8, 14.3, 14.0, 13.8, 13.7, 13.5, 13.2, 12.9, 12.0, 9.2, 8.4, 8.0, 7.6, 7.3, 7.2, 5.6, 1.5, 0.9 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
PTK2-001
 
PTK2-002
 
PTK2-003
 
PTK2-007
 
PTK2-008
 
PTK2-010
 
PTK2-011
 
PTK2-052
 
PTK2-057
 
PTK2-201
 
PTK2-202
 
PTK2-203
 
 »