SDC2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044416

 

Antibody CAB025123

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA044416 MAB29651 

Host species

Rabbit Rat 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

62  

Antigen sequence

KVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEK
HSDSLFKRTEVL
 
 

Matching transcripts

SDC2-001 - ENSP00000307046 [100%]
SDC2-002 - ENSP00000429045 [100%]
SDC2-003 - ENSP00000428256 [100%]
SDC2-004 - ENSP00000429121 [100%]
SDC2-005 - ENSP00000429662 [100%]
SDC2-006 - ENSP00000427784 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human prostate shows strong cytoplasmic positivity with a granular pattern in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:75 

Validation IH

 Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

22.2, 19.0, 18.4, 16.0, 14.9 22.2, 19.0, 18.4, 16.0, 14.9 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
  

Antibody dilution

1:200  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SDC2-001
 
SDC2-002
 
SDC2-003
 
SDC2-004
 
SDC2-005
 
SDC2-006