GJB1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA010663

 

Antibody CAB012994

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Zymed
 

Product name

HPA010663 35-8900 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

67  

Antigen sequence

ACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRR
SPGTGAGLAEKSDRCSA
 
 

Matching transcripts

GJB1-001 - ENSP00000363134 [100%]
GJB1-002 - ENSP00000354900 [100%]
GJB1-003 - ENSP00000363141 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic and extracellular positivity in cells of tubules.
More information
 Immunohistochemical staining of human duodenum shows distinct cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:15 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

32.0 32.0, 9.5 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GJB1-001
 
GJB1-002
 
GJB1-003