GYPA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014811

 

Antibody CAB002658

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA014811 MS-1070 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

60  

Antigen sequence

TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGER
VQLAHHFSEP
 
 

Matching transcripts

GYPA-001 - ENSP00000354003 [100%]
GYPA-201 - ENSP00000445398 [100%]
GYPA-202 - ENSP00000478329 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bone marrow shows cytoplasmic positivity in erythrocytes.
More information
 Immunohistochemical staining of human bone marrow shows cytoplasmic positivity in erythrocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:300 1:50 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 

Antibody dilution

1:133 1:50 

Validation IF

Non-supportive: The subcellular location is not consistent with experimental gene/protein characterization data, or conflicting with an independent antibody. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

16.4, 16.2 16.4, 16.2, 14.9, 13.0, 12.8, 11.3, 9.3 

Antibody dilution

1:250 1:500 

Validation WB

Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GYPA-001
 
GYPA-201
 
GYPA-202