DCLK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015770

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA015770 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

102 

Antigen sequence

ENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKHC
QDSGRPGMEPISPVPPSVEEIPVPGEAVPAPTPPESPTPHCPPAAPGGER
AG
 

Matching transcripts

DCLK2-001 - ENSP00000296550 [99%]
DCLK2-003 - ENSP00000303887 [99%]
DCLK2-004 - ENSP00000427235 [99%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:400 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

85.4, 83.6, 83.5 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:25000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
DCLK2-001
 
DCLK2-003
 
DCLK2-004