GPRC5C

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029776

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029776 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

70 

Antigen sequence

TSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSA
QSHQAATPPKDGKNSQVFRN
 

Matching transcripts

GPRC5C-001 - ENSP00000376403 [100%]
GPRC5C-003 - ENSP00000376405 [100%]
GPRC5C-006 - ENSP00000340595 [100%]
GPRC5C-009 - ENSP00000376404 [94%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong luminal membrane positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:135 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY429581)
More information
 

Target mass (kDa)

52.9, 50.1, 49.4, 14.0 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
GPRC5C-001
 
GPRC5C-003
 
GPRC5C-006
 
GPRC5C-009