HARS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036539

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036539 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

64 

Antigen sequence

MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDES
KQKFVLKTPKGTRD
 

Matching transcripts

HARS-001 - ENSP00000425634 [100%]
HARS-006 - ENSP00000425889 [100%]
HARS-009 - ENSP00000387893 [100%]
HARS-011 - ENSP00000411085 [100%]
HARS-008 - ENSP00000304668 [95%]
HARS-012 - ENSP00000411511 [95%]
HARS-005 - ENSP00000393244 [94%]
HARS-014 - ENSP00000421576 [94%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human skin shows strong cytoplasmic positivity in epidermal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:600 

Literature conformity

Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

1:58 

Validation IF

Supportive: The subcellular location is supported by literature. 

         siRNA

Image

 

Description

Signal downregulation > 25% by one siRNA.
More information
 

Antibody dilution

1:58 

Validation siRNA

Supportive: The siRNA validation is supportive. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.4, 54.8, 52.7, 50.2, 48.6, 43.9, 31.9, 6.7 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HARS-001
 
HARS-005
 
HARS-006
 
HARS-008
 
HARS-009
 
HARS-011
 
HARS-012
 
HARS-014