PFKFB3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008266

 

Antibody HPA043889

 

Antibody CAB020795

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA008266 HPA043889 3058.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 12 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

137 51  

Antigen sequence

EEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAK
ENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRIS
CYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQD
 
YLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEH
V
 
 

Matching transcripts

PFKFB3-001 - ENSP00000369115 [100%]
PFKFB3-002 - ENSP00000369100 [100%]
PFKFB3-006 - ENSP00000353712 [100%]
PFKFB3-007 - ENSP00000436885 [100%]
PFKFB3-008 - ENSP00000434628 [100%]
PFKFB3-009 - ENSP00000432356 [100%]
PFKFB3-010 - ENSP00000369111 [100%]
PFKFB3-012 - ENSP00000433771 [100%]
PFKFB3-015 - ENSP00000369105 [100%]
PFKFB3-201 - ENSP00000369108 [100%]
PFKFB3-203 - ENSP00000446384 [100%]
 PFKFB3-001 - ENSP00000369115 [100%]
PFKFB3-002 - ENSP00000369100 [100%]
PFKFB3-005 - ENSP00000416677 [100%]
PFKFB3-006 - ENSP00000353712 [100%]
PFKFB3-010 - ENSP00000369111 [100%]
PFKFB3-015 - ENSP00000369105 [100%]
PFKFB3-201 - ENSP00000369108 [100%]
PFKFB3-203 - ENSP00000446384 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
  Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in Parietal cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:35  1:175 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data  Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-549 shows positivity in nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:40 1:8  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401447)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

60.6, 60.3, 59.6, 58.9, 58.8, 57.3, 52.6 60.6, 60.3, 59.6, 58.9, 58.8, 57.3, 10.0 60.6, 60.3, 59.6, 58.9, 58.8, 57.3, 52.6, 21.0, 16.5, 10.0, 6.4, 3.6 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
PFKFB3-001
 
PFKFB3-002
 
PFKFB3-005
 
PFKFB3-006
 
PFKFB3-007
 
PFKFB3-008
 
PFKFB3-009
 
PFKFB3-010
 
PFKFB3-012
 
PFKFB3-015
 
PFKFB3-201
 
PFKFB3-203
 
 »