ZDHHC16

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039893

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039893 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

80 

Antigen sequence

VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTG
RHWLTRVLLPSSHLPHGNGMSWEPPPWVTA
 

Matching transcripts

ZDHHC16-003 - ENSP00000359891 [100%]
ZDHHC16-004 - ENSP00000345383 [100%]
ZDHHC16-005 - ENSP00000323360 [100%]
ZDHHC16-006 - ENSP00000304487 [100%]
ZDHHC16-007 - ENSP00000359879 [100%]
ZDHHC16-013 - ENSP00000359883 [100%]
ZDHHC16-201 - ENSP00000377357 [100%]
ZDHHC16-016 - ENSP00000405240 [98%]
ZDHHC16-017 - ENSP00000396286 [98%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:57 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

43.6, 41.8, 38.9, 37.1, 35.0, 34.3 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ZDHHC16-003
 
ZDHHC16-004
 
ZDHHC16-005
 
ZDHHC16-006
 
ZDHHC16-007
 
ZDHHC16-013
 
ZDHHC16-016
 
ZDHHC16-017
 
ZDHHC16-201