ZDHHC16

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039893

 

Antibody HPA040214

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039893 HPA040214 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

80 45 

Antigen sequence

VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTG
RHWLTRVLLPSSHLPHGNGMSWEPPPWVTA
 
LFREAYAAIEKMKQLDKNKLQAVANQTYHQTPPPTFSFRERMTHK
 

Matching transcripts

ZDHHC16-003 - ENSP00000359891 [100%]
ZDHHC16-004 - ENSP00000345383 [100%]
ZDHHC16-005 - ENSP00000323360 [100%]
ZDHHC16-006 - ENSP00000304487 [100%]
ZDHHC16-007 - ENSP00000359879 [100%]
ZDHHC16-013 - ENSP00000359883 [100%]
ZDHHC16-201 - ENSP00000377357 [100%]
ZDHHC16-016 - ENSP00000405240 [98%]
ZDHHC16-017 - ENSP00000396286 [98%]
 ZDHHC16-003 - ENSP00000359891 [100%]
ZDHHC16-005 - ENSP00000323360 [100%]
ZDHHC16-010 - ENSP00000398532 [100%]
ZDHHC16-017 - ENSP00000396286 [100%]
ZDHHC16-201 - ENSP00000377357 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:150  

Literature conformity

No avaliable gene/protein characterization data  

RNA consistency

Not done  

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in nucleus, nuclear membrane & cytoplasm.
More information
 

Antibody dilution

 1:93 

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

43.6, 41.8, 38.9, 37.1, 35.0, 34.3 43.6, 38.9, 35.0, 28.1 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ZDHHC16-003
 
ZDHHC16-004
 
ZDHHC16-005
 
ZDHHC16-006
 
ZDHHC16-007
 
ZDHHC16-010
 
ZDHHC16-013
 
ZDHHC16-016
 
ZDHHC16-017
 
ZDHHC16-201