CLCN5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000401

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000401 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

122 

Antigen sequence

EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGF
PVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLP
PYTPPTLKLQNILDLSPFTVTD
 

Matching transcripts

CLCN5-001 - ENSP00000365256 [99%]
CLCN5-002 - ENSP00000365259 [99%]
CLCN5-003 - ENSP00000304257 [99%]
CLCN5-004 - ENSP00000365276 [99%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows moderate granular positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

90.8, 83.1 

Antibody dilution

1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CLCN5-001
 
CLCN5-002
 
CLCN5-003
 
CLCN5-004