HOPX

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030180

 

Antibody CAB018632

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA030180 sc-30216 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

91  

Antigen sequence

MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTT
LCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
 
 

Matching transcripts

HOPX-011 - ENSP00000422175 [100%]
HOPX-201 - ENSP00000396275 [100%]
HOPX-001 - ENSP00000424101 [80%]
HOPX-003 - ENSP00000337330 [80%]
HOPX-006 - ENSP00000315198 [80%]
HOPX-009 - ENSP00000451794 [80%]
HOPX-010 - ENSP00000452340 [80%]
HOPX-015 - ENSP00000452003 [80%]
HOPX-016 - ENSP00000452098 [80%]
HOPX-017 - ENSP00000370654 [80%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity, with a granular pattern, in neuronal cells.
More information
 Immunohistochemical staining of human oral mucosa shows nuclear and cytoplasmic positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1500 1:300 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

10.4, 8.3 12.6, 10.5, 10.4, 8.3, 7.3 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:30000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
HOPX-001
 
HOPX-003
 
HOPX-006
 
HOPX-009
 
HOPX-010
 
HOPX-011
 
HOPX-015
 
HOPX-016
 
HOPX-017
 
HOPX-201