MAP6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039061

 

Antibody HPA039062

 

Antibody CAB015442

 

Antibody CAB022600

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Chemicon
 

Product name

HPA039061 HPA039062 sc-53513 MAB5524 

Host species

Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Serum 

Released in version

10 10 5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known Native protein 

Length (aa)

113 89   

Antigen sequence

TSASHKPTRKAKDKQAVSGQAAKKKSAEGPSTTKPDDKEQSKEMNNKLAE
AKESLAQPVSDSSKTQGPVATEPDKDQGSVVPGLLKGQGPMVQEPLKKQG
SVVPGPPKDLGPM
 
KGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDESAMATAPIKNQGSM
VSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVAPVK
 
 
 

Matching transcripts

MAP6-001 - ENSP00000307093 [100%]
MAP6-004 - ENSP00000434278 [100%]
 MAP6-001 - ENSP00000307093 [100%]
MAP6-004 - ENSP00000434278 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in purkinje cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells and cells in molecular layer.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells and cells in molecular layer.
More information
 Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:2500 1:3000 1:25 1:600 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

86.5, 51.3 86.5, 51.3 86.5, 51.3, 47.4 86.5, 51.3, 47.4 

Antibody dilution

1:250 1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:6000 1:6000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
MAP6-001
 
MAP6-004