BPTF

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029069

 

Antibody HPA048724

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029069 HPA048724 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

129 35 

Antigen sequence

SKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVIMKG
NINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLT
PAGEFKWNGSVHGSKVLTISTLRLTITQL
 
GILQSEAELIDEYVCPQCQSTEDVMTVLTPLTEKD
 

Matching transcripts

BPTF-001 - ENSP00000388405 [100%]
BPTF-002 - ENSP00000307208 [100%]
BPTF-009 - ENSP00000440854 [100%]
BPTF-201 - ENSP00000315454 [100%]
BPTF-202 - ENSP00000334351 [100%]
 BPTF-001 - ENSP00000388405 [97%]
BPTF-002 - ENSP00000307208 [97%]
BPTF-004 - ENSP00000463845 [97%]
BPTF-006 - ENSP00000343837 [97%]
BPTF-201 - ENSP00000315454 [97%]
BPTF-202 - ENSP00000334351 [97%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:100  

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & microtubules.
More information
 

Antibody dilution

1:95 1:172 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Target too small/large to be analyzed with the present setup Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

338.3, 325.1, 322.2, 308.1, 271.5 338.3, 325.1, 322.2, 308.1, 72.5, 48.3 

Antibody dilution

 1:870 

Validation WB

 Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:6950 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BPTF-001
 
BPTF-002
 
BPTF-004
 
BPTF-006
 
BPTF-009
 
BPTF-201
 
BPTF-202