GAP43

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA013392

 

Antibody HPA015600

 

Antibody CAB004417

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA013392 HPA015600 sc-17790 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

64 106  

Antigen sequence

KEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEA
VDETKPKESARQDE
 
SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEA
APATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET
ESATKA
 
 

Matching transcripts

GAP43-001 - ENSP00000305010 [100%]
GAP43-002 - ENSP00000377372 [100%]
 GAP43-001 - ENSP00000305010 [100%]
GAP43-002 - ENSP00000377372 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows distinct neuropil positivity.
More information
 Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal and glial cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:2000 1:250 1:75 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400750)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

28.8, 24.8 28.8, 24.8 28.8, 24.8 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GAP43-001
 
GAP43-002