LAMB2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001895

 

Antibody HPA050033

 

Antibody CAB000053

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA001895 HPA050033 Z0097 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein 

Length (aa)

133 129  

Antigen sequence

DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYD
SIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNS
KHMANQRALGKLSAHTHTLSLTDINELVCGAPG
 
SLCGHLVPKDDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLVRTGGS
AQPETPYSGPGLLIDSLVLLPRVLVLEMFSGGDAAALERQATFERYQCHE
EGLVPSKTSPSEACAPLLISLSTLIYNGA
 
 

Matching transcripts

LAMB2-001 - ENSP00000388325 [100%]
LAMB2-003 - ENSP00000307156 [100%]
 LAMB2-001 - ENSP00000388325 [100%]
LAMB2-003 - ENSP00000307156 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human heart muscle shows distinct membranous positivity in myocytes.
More information
  Immunohistochemical staining of human heart muscle shows strong cytoplasmic and membranous positivity in myocytes.
More information
 

Retrieval method

HIER pH6  Proteinase K. 

Antibody dilution

1:100  1:500 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data  Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

196.0 196.0 196.0, 17.3 

Antibody dilution

1:250 1:320 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:2550  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line HeLa shows positivity in vesicles.
More information
  

Antibody dilution

 1:64  

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available.  
 

ANTIGEN VIEW

? »
 
 
 
LAMB2-001
 
LAMB2-003