EIF2AK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015737

 

Antibody CAB009204

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA015737 sc-13073 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

126  

Antigen sequence

NAWLEAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFAT
KEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESV
DAAYNLQDSCLTDCDVEDGTMDGNDE
 
 

Matching transcripts

EIF2AK3-001 - ENSP00000307235 [100%]
EIF2AK3-003 - ENSP00000408325 [100%]
EIF2AK3-004 - ENSP00000412076 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows cytoplasmic and nuclear positivity in both glomeruli and renal tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:225 1:35 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

125.2, 109.9, 108.9 125.2, 109.9, 108.9 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:150000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
EIF2AK3-001
 
EIF2AK3-003
 
EIF2AK3-004