INSL5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030100

 

Antibody CAB033849

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA030100 sc-67190 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

84  

Antigen sequence

LEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQ
NLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSR
 
 

Matching transcripts

INSL5-001 - ENSP00000302724 [99%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in a subset of glandular cells.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in a few glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1000 1:200 

Validation IH

Supportive: Two (or more) antibodies yielding dissimilar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417280)
More information
  

Target mass (kDa)

15.3 15.3 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
INSL5-001