FGGY

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052442

 

Antibody HPA054971

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA052442 HPA054971 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

100 93 

Antigen sequence

FVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATA
RCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGM
 
EPQFNHHEQSSEDIWAACCVVTKKVVQGIDLNQIRGLGFDATCSLVVLDK
QFHPLPVNQEGDSHRNVIMWLDHRAVSQVNRINETKHSVLQYV
 

Matching transcripts

FGGY-001 - ENSP00000305922 [100%]
FGGY-002 - ENSP00000360254 [100%]
FGGY-004 - ENSP00000403425 [100%]
FGGY-005 - ENSP00000360262 [100%]
FGGY-006 - ENSP00000360256 [100%]
 FGGY-001 - ENSP00000305922 [100%]
FGGY-004 - ENSP00000403425 [100%]
FGGY-005 - ENSP00000360262 [100%]
FGGY-007 - ENSP00000406607 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:450 1:350 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

62.5, 60.0, 54.7, 50.0, 27.5 62.5, 60.0, 54.7, 20.8 

Antibody dilution

1:570 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:4550 1:2050 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
FGGY-001
 
FGGY-002
 
FGGY-004
 
FGGY-005
 
FGGY-006
 
FGGY-007