AGXT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035370

 

Antibody HPA035371

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035370 HPA035371 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

84 85 

Antigen sequence

HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELC
HRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS
 
QLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGK
VLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL
 

Matching transcripts

AGXT-001 - ENSP00000302620 [100%]
 AGXT-001 - ENSP00000302620 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1500 1:1000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 

Antibody dilution

 1:127 

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

43.0 43.0 

Antibody dilution

1:250 1:250 

Validation WB

Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AGXT-001