ACOT12

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037723

 

Antibody HPA037724

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA037723 HPA037724 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

96 86 

Antigen sequence

SIKVMVQDMLTGIEKLVSVAFSTFVAKPVGKEKIHLKPVTLLTEQDHVEH
NLAAERRKVRLQHEDTFNNLMKESSKFDDLIFDEEEGAVSTRGTSV
 
CIHWDISKQASLSDSNVEALKKLAAKRGWEVTSTVEKIKIYTLEEHDVLS
VWVEKHVGSPAHLAYRLLSDFTKRPLWDPHFVSCEV
 

Matching transcripts

ACOT12-001 - ENSP00000303246 [100%]
ACOT12-002 - ENSP00000421628 [81%]
 ACOT12-001 - ENSP00000303246 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human thyroid gland shows strong cytoplasmic and extracellular positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:65 1:18 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Not consistent with RNA expression data Not consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line SK-MEL-30 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line SK-MEL-30 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:41 1:44 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408930)
More information
  

Target mass (kDa)

62.0, 18.3 62.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Current setup is not applicable due to low RNA count 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ACOT12-001
 
ACOT12-002