ACOT12

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037723

 

Antibody HPA037724

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA037723 HPA037724 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

96 86 

Antigen sequence

SIKVMVQDMLTGIEKLVSVAFSTFVAKPVGKEKIHLKPVTLLTEQDHVEH
NLAAERRKVRLQHEDTFNNLMKESSKFDDLIFDEEEGAVSTRGTSV
 
CIHWDISKQASLSDSNVEALKKLAAKRGWEVTSTVEKIKIYTLEEHDVLS
VWVEKHVGSPAHLAYRLLSDFTKRPLWDPHFVSCEV
 

Matching transcripts

ACOT12-001 - ENSP00000303246 [100%]
ACOT12-002 - ENSP00000421628 [81%]
 ACOT12-001 - ENSP00000303246 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human thyroid gland shows strong cytoplasmic and extracellular positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:65 1:18 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408930)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

62.0, 18.3 62.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ACOT12-001
 
ACOT12-002