CORO1B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040113

 

Antibody CAB017616

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA040113 sc-66838 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

94  

Antigen sequence

AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSL
ARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD
 
 

Matching transcripts

CORO1B-001 - ENSP00000340211 [99%]
CORO1B-201 - ENSP00000377471 [99%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human prostate shows strong positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:300 

Literature conformity

 Consistent with gene/protein characterization data 

RNA consistency

 Not at all consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:200 1:75 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

54.2 54.2, 31.8, 31.0, 20.2 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CORO1B-001
 
CORO1B-201