FRG2C

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039264

 

Antibody HPA047769

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039264 HPA047769 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

53 35 

Antigen sequence

MGKGNEDPDLHCSSIQCSTDQPPFQQISFTEKGSDEKKPFKEKGKTAFSH
SSE
 
AGSEPNPNKENSEETKLKAGNSTAGSEPESSSYRE
 

Matching transcripts

FRG2C-001 - ENSP00000312299 [98%]
FRG2C-002 - ENSP00000419432 [98%]
 FRG2C-001 - ENSP00000312299 [94%]
FRG2C-002 - ENSP00000419432 [91%]
 

Other gene match

CT476828.1 - ENSG00000148828 [98%]
FRG2 - ENSG00000205097 [98%]
FRG2C - ENSG00000220903 [98%]
FRG2B - ENSG00000225899 [100%]
 CT476828.1 - ENSG00000148828 [100%]
FRG2 - ENSG00000205097 [100%]
FRG2C - ENSG00000220903 [94%]
FRG2B - ENSG00000225899 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:80 1:10 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

30.8, 30.7, 30.6, 30.5 30.8, 30.7, 30.6, 30.5 

Antibody dilution

1:250 1:170 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:1350 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
FRG2C-001
 
FRG2C-002