BNC2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018525

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA018525 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

128 

Antigen sequence

YENESESSEPKLGEESMEGDEHIHSEVSEKVLMNSERPDENHSEPSHQDV
IKVKEEFTDPTYDMFYMSQYGLYNGGGASMAALHESFTSSLNYGSPQKFS
PEGDLCSSPDPKICYVCKKSFKSSYSVK
 

Matching transcripts

BNC2-001 - ENSP00000431516 [100%]
BNC2-005 - ENSP00000392212 [100%]
BNC2-008 - ENSP00000370047 [100%]
BNC2-009 - ENSP00000408370 [100%]
BNC2-010 - ENSP00000370042 [100%]
BNC2-201 - ENSP00000370041 [100%]
BNC2-202 - ENSP00000444640 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows distinct positivity in basal cells of ductus seminiferus.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:400 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & cytoplasm.
More information
 

Antibody dilution

1:154 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

122.3, 114.5, 111.4, 101.3, 96.5, 36.9 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BNC2-001
 
BNC2-005
 
BNC2-008
 
BNC2-009
 
BNC2-010
 
BNC2-201
 
BNC2-202