AHSA2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051137

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051137 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

80 

Antigen sequence

DGNITGEYLGLLTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLK
EFLSICKEENMKFCWQKQHFEEIKGSLQLT
 

Matching transcripts

AHSA2-001 - ENSP00000377970 [86%]
AHSA2-002 - ENSP00000349525 [86%]
AHSA2-009 - ENSP00000386721 [86%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:450 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoskeleton (microtubules) & cytoskeleton (cytokinetic bridge).
More information
 

Antibody dilution

1:105 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

16.8, 15.7 

Antibody dilution

1:520 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:4200 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
AHSA2-001
 
AHSA2-002
 
AHSA2-009