GPR64

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001478

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001478 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

137 

Antigen sequence

SPTVSAPANVNTTSAPPVQTDIVNTSSISDLENQVLQMEKALSLGSLEPN
LAGEMINQVSRLLHSPPDMLAPLAQRLLKVVDDIGLQLNFSNTTISLTSP
SLALAVIRVNASSFNTTTFVAQDPANLQVSLETQAPE
 

Matching transcripts

GPR64-001 - ENSP00000369202 [100%]
GPR64-002 - ENSP00000350152 [100%]
GPR64-003 - ENSP00000369198 [100%]
GPR64-005 - ENSP00000353421 [100%]
GPR64-006 - ENSP00000350680 [100%]
GPR64-007 - ENSP00000349015 [100%]
GPR64-201 - ENSP00000346845 [100%]
GPR64-202 - ENSP00000369205 [100%]
GPR64-203 - ENSP00000369207 [100%]
GPR64-008 - ENSP00000344972 [94%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human epididymis shows cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Not at all consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

111.6, 111.3, 110.0, 109.2, 108.5, 106.4, 98.7 

Antibody dilution

1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
GPR64-001
 
GPR64-002
 
GPR64-003
 
GPR64-005
 
GPR64-006
 
GPR64-007
 
GPR64-008
 
GPR64-201
 
GPR64-202
 
GPR64-203