STAT5B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042128

 

Antibody HPA049883

 

Antibody HPA051156

 

Antibody CAB004298

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA042128 HPA049883 HPA051156 sc-1656 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 13 13 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

74 48 49  

Antigen sequence

EGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNA
TITDIISALVTSTFIIEKQPPQVL
 
KTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRN
 
LEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQ
 
 

Matching transcripts

STAT5B-001 - ENSP00000293328 [100%]
 STAT5B-001 - ENSP00000293328 [100%]
 STAT5B-001 - ENSP00000293328 [100%]
  

Other gene match

STAT5A - ENSG00000126561 [100%]
 STAT5A - ENSG00000126561 [100%]
 STAT5A - ENSG00000126561 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human lymph node shows strong nuclear positivity in non-germinal center cells.
More information
 Immunohistochemical staining of human lymph node shows distinct cytoplasmic positivity in subsets of lymphoid cells.
More information
 Immunohistochemical staining of human lymph node shows distinct cytoplasmic positivity in subsets of lymphoid cells.
More information
 Immunohistochemical staining of human tonsil shows distinct cytoplasmic and nuclear positivity in cells in spleen.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:75 1:85 1:200 1:300 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done 

         Western Blot

Image

    

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

90.6, 90.3, 89.9, 87.4, 86.9 90.6, 90.3, 89.9, 87.4, 86.9 90.6, 90.3, 89.9, 87.4, 86.9, 16.7 89.9, 18.0 

Antibody dilution

1:250 1:260 1:190 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:2100 1:1550  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
STAT5B-001