CD34

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036722

 

Antibody HPA036723

 

Antibody CAB000018

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA036722 HPA036723 M7165 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

13 13 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein 

Length (aa)

72 75  

Antigen sequence

ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFK
KDRGEGLARVLCGEEQADADAG
 
LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQ
ENGTGQATSRNGHSARQHVVADTEL
 
 

Matching transcripts

CD34-001 - ENSP00000310036 [100%]
CD34-002 - ENSP00000348916 [100%]
 CD34-001 - ENSP00000310036 [100%]
CD34-003 - ENSP00000356003 [100%]
CD34-201 - ENSP00000442874 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong positivity in Blood vessels / endothelial cells.
More information
 Immunohistochemical staining of human bone marrow shows moderate nuclear positivity in hematopoietic cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH9 

Antibody dilution

1:100 1:200 1:100 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Not done Mainly consistent with RNAseq data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

40.7, 35.0 40.7, 27.1, 24.5 40.7, 35.0, 27.1, 24.5 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500 1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CD34-001
 
CD34-002
 
CD34-003
 
CD34-201