CTSF

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031431

 

Antibody HPA055610

 

Antibody CAB002141

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA031431 HPA055610 NCL-CATH-F 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

82 77  

Antigen sequence

NHPDNRNETFSSVISLLNEDPLSQDLPVKMASIFKNFVITYNRTYESKEE
ARWRLSVFVNNMVRAQKIQALDRGTAQYGVTK
 
SLYSLEATLEEPPCNDPMVCRLPVSKKTLLCSFQVLDELGRHVLLRKDCG
PVDTKVPGAGEPKSAFTQGSAMISSLS
 
 

Matching transcripts

CTSF-001 - ENSP00000310832 [100%]
CTSF-009 - ENSP00000433082 [99%]
 CTSF-001 - ENSP00000310832 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

  Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:60 

Validation IH

  Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

53.4, 31.8 53.4 53.4, 31.8, 13.5, 8.9 

Antibody dilution

1:250 1:720 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-549 shows positivity in plasma membrane, cytoplasm & vesicles.
More information
 Immunofluorescent staining of human cell line HeLa shows positivity in cytoplasm.
More information
  

Antibody dilution

1:156 1:143  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Non-supportive: The subcellular location is not consistent with literature.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:5750  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CTSF-001
 
CTSF-009