SOCS7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003484

 

Antibody HPA004475

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003484 HPA004475 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

141 143 

Antigen sequence

ETVSLVDVDISQRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPM
GSSLQSFPLPPPPPPHAPDAFPRIAPIRAAESLHSQPPQHLQCPLYRPDS
SSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRD
 
LETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLS
RGEQQQQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGG
SGGGDGTGKRPSGELAASAASLTDMGGSAGRELDAGRKPKLTR
 

Matching transcripts

SOCS7-001 - ENSP00000464034 [100%]
 SOCS7-001 - ENSP00000464034 [100%]
SOCS7-002 - ENSP00000330659 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus, nucleoli & vesicles.
More information
 Application not done for this antibody. 

Antibody dilution

1:10  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.0 63.0, 59.6 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human testis shows nuclear positivity in subset of cells in seminiferous ducts.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:25 

Literature conformity

 Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNAseq data 
 

ANTIGEN VIEW

? »
 
 
 
SOCS7-001
 
SOCS7-002