KLK15

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019802

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA019802 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

74 

Antigen sequence

QDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSR
FMRVRLGEHNLRKRDGPEQLRTTS
 

Matching transcripts

KLK15-001 - ENSP00000314783 [100%]
KLK15-002 - ENSP00000471164 [100%]
KLK15-003 - ENSP00000469315 [100%]
KLK15-004 - ENSP00000468856 [100%]
KLK15-201 - ENSP00000301421 [100%]
KLK15-202 - ENSP00000415136 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach shows distinct positivity in Chief cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:7 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402593)
More information
 

Target mass (kDa)

28.1, 28.0, 19.3, 18.0, 17.9, 13.8 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
KLK15-001
 
KLK15-002
 
KLK15-003
 
KLK15-004
 
KLK15-201
 
KLK15-202