LEP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030721

 

Antibody CAB010490

 

Antibody CAB016730

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 BioPorto Diagnostics A/S
 

Product name

HPA030721 sc-9014 ABS 022-03 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

12 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

62   

Antigen sequence

TLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVY
QQILTSRPSRNV
 
 
 

Matching transcripts

LEP-001 - ENSP00000312652 [98%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human epididymis shows distinct positivity in plasma.
More information
 Immunohistochemical staining of human duodenum shows positivity in plasma.
More information
 Immunohistochemical staining of human duodenum shows distinct positivity in plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:115 1:80 1:150 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

   

Target mass (kDa)

18.6 18.6 18.6 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
LEP-001