HRAS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA049830

 

Antibody CAB002015

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Upstate
 

Product name

HPA049830 05-516 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

34  

Antigen sequence

EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV
 
 

Matching transcripts

HRAS-001 - ENSP00000434023 [94%]
HRAS-002 - ENSP00000309845 [94%]
HRAS-004 - ENSP00000380722 [94%]
HRAS-009 - ENSP00000380723 [94%]
HRAS-201 - ENSP00000388246 [94%]
HRAS-202 - ENSP00000407586 [94%]
  

Other gene match

KRAS - ENSG00000133703 [100%]
NRAS - ENSG00000213281 [85%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:400 

Validation IH

Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

21.7, 21.4, 21.3, 21.2, 18.9 21.3, 18.9 

Antibody dilution

1:80 1:500 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
HRAS-001
 
HRAS-002
 
HRAS-004
 
HRAS-009
 
HRAS-201
 
HRAS-202