KIAA2018

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029243

 

Antibody HPA029245

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029243 HPA029245 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

80 87 

Antigen sequence

LTSRGLEQQMVSQPSIVTRSSDMTCTPHRPERNRVSSYSAEALIGKTSSN
SEQRMGISIQGSRVSDQLEMRSYLDVPRNK
 
LKANDICLYDDPTIHWKGNLKNSKVSVVIPSDQVQKKIIVYSNGNQPGGN
SQGTAVQGITFNVSHNLQKQTANVVPVQRTCNLVTPV
 

Matching transcripts

KIAA2018-003 - ENSP00000420721 [100%]
KIAA2018-201 - ENSP00000320794 [100%]
 KIAA2018-003 - ENSP00000420721 [100%]
KIAA2018-201 - ENSP00000320794 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human salivary gland shows strong cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:150 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in centrosome.
More information
 

Antibody dilution

1:100 1:100 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup 

Target mass (kDa)

241.7 241.7 

Antibody dilution

  

Validation WB

Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
KIAA2018-003
 
KIAA2018-201