BASP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045218

 

Antibody HPA050333

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA045218 HPA050333 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

42 37 

Antigen sequence

MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP
 
TEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVK
 

Matching transcripts

BASP1-001 - ENSP00000319281 [100%]
BASP1-003 - ENSP00000476090 [100%]
 BASP1-001 - ENSP00000319281 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil, neuronal and glial cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:250  

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416732)
More information
  

Target mass (kDa)

22.7, 4.9 22.7 

Antibody dilution

1:250 1:200 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:1550 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line HeLa shows positivity in plasma membrane.
More information
 

Antibody dilution

 1:39 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
BASP1-001
 
BASP1-003