DPP7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021282

 

Antibody HPA059381

 

Antibody CAB025541

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 

Product name

HPA021282 HPA059381 MAB34381 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

5 13 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

71 74  

Antigen sequence

MFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSEAQRITGLRAL
AGLVYNASGSEHCYDIYRLYH
 
SNGNLDPWAGGGIRRNLSASVIAVTIQGGAHHLDLRASHPEDPASVVEAR
KLEATIIGEWVKAARREQQPALRG
 
 

Matching transcripts

DPP7-003 - ENSP00000360635 [100%]
 DPP7-003 - ENSP00000360635 [100%]
DPP7-008 - ENSP00000473309 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:150  1:1500 

Literature conformity

Consistent with extensive gene/protein characterization data  Consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in the Golgi apparatus & vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 Application not done for this antibody. 

Antibody dilution

1:32 1:22  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

54.3 54.3, 26.6 54.3, 29.4, 26.6, 16.9, 12.9, 6.2, 2.0 

Antibody dilution

1:250 1:80 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:600  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
DPP7-003
 
DPP7-008