RPS6KA3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003221

 

Antibody CAB003853

 

Antibody CAB013520

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 Zymed
 

Product name

HPA003221 1474-1 38-6800 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb mAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant Not known 

Released in version

4 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Not known 

Length (aa)

144   

Antigen sequence

MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEI
AITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMK
VLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY
 
 
 

Matching transcripts

RPS6KA3-001 - ENSP00000368884 [100%]
RPS6KA3-003 - ENSP00000388512 [81%]
RPS6KA3-202 - ENSP00000444837 [81%]
RPS6KA3-203 - ENSP00000440220 [81%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:350 1:300 1:50 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

83.7, 80.7, 80.6, 15.3 83.7, 80.7, 80.6, 26.2, 15.3 83.7, 80.7, 80.6, 26.2, 15.3 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
RPS6KA3-001
 
RPS6KA3-003
 
RPS6KA3-202
 
RPS6KA3-203