CD151

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011906

 

Antibody CAB002428

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA011906 NCL-CD151 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

98  

Antigen sequence

LNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDS
EWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETF
 
 

Matching transcripts

CD151-001 - ENSP00000380565 [100%]
CD151-002 - ENSP00000432385 [100%]
CD151-201 - ENSP00000324101 [100%]
CD151-202 - ENSP00000380566 [100%]
CD151-014 - ENSP00000432990 [98%]
CD151-019 - ENSP00000432258 [88%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:60 1:75 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

28.3, 28.1, 19.8 28.3, 28.1, 20.3, 19.8, 19.2, 10.1, 9.8, 8.5, 7.2 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CD151-001
 
CD151-002
 
CD151-014
 
CD151-019
 
CD151-201
 
CD151-202