ERBB4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA012016

 

Antibody CAB000276

 

Antibody CAB025522

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 R&D systems
 

Product name

HPA012016 RB9045 MAB1131 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

5 1 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Recombinant protein 

Length (aa)

103   

Antigen sequence

LPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSN
RNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGT
LRK
 
 
 

Matching transcripts

ERBB4-002 - ENSP00000403204 [100%]
ERBB4-001 - ENSP00000342235 [87%]
ERBB4-201 - ENSP00000385565 [87%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows moderate nuclear and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH9 HIER pH6 

Antibody dilution

1:50 1:150 1:300 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

146.8, 145.6, 145.2 146.8, 145.6, 145.2, 80.9, 14.6 146.8, 145.6, 145.2, 80.9, 14.6 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
ERBB4-001
 
ERBB4-002
 
ERBB4-201