MPI

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007200

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007200 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

129 

Antigen sequence

GSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTL
SQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKL
HLQAPQHYPDANHKPEMAIALTPFQGLCG
 

Matching transcripts

MPI-001 - ENSP00000318318 [100%]
MPI-003 - ENSP00000455405 [100%]
MPI-005 - ENSP00000457885 [100%]
MPI-006 - ENSP00000455241 [100%]
MPI-008 - ENSP00000318192 [100%]
MPI-013 - ENSP00000457020 [100%]
MPI-014 - ENSP00000455161 [100%]
MPI-015 - ENSP00000454619 [100%]
MPI-022 - ENSP00000455383 [100%]
MPI-023 - ENSP00000457013 [100%]
MPI-012 - ENSP00000455477 [91%]
MPI-019 - ENSP00000455065 [91%]
MPI-021 - ENSP00000455972 [89%]
MPI-010 - ENSP00000454622 [87%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:50 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

46.7, 44.4, 39.8, 37.7, 35.5, 31.9, 29.3, 23.7, 20.4, 19.5, 19.4, 19.1, 13.2 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
MPI-001
 
MPI-003
 
MPI-005
 
MPI-006
 
MPI-008
 
MPI-010
 
MPI-012
 
MPI-013
 
MPI-014
 
MPI-015
 
MPI-019
 
MPI-021
 
MPI-022
 
MPI-023
 
 »