ZNF852

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048312

 

Antibody HPA049885

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA048312 HPA049885 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

31 49 

Antigen sequence

YKEVEEHPPLSSSPVEHEGVLKGQKSYRCDE
 
NLMNVLSVGKPLVSVPLLITTSELMLERSPQVWLGHLLKAWFSETDSKD
 

Matching transcripts

ZNF852-001 - ENSP00000389841 [100%]
 ZNF852-001 - ENSP00000389841 [100%]
 

Other gene match

ZKSCAN7 - ENSG00000196345 [97%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
More information
 Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:350 1:100 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

85.0, 62.1, 41.5 62.1 

Antibody dilution

1:320 1:280 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2550 1:2250 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ZNF852-001