HYI

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040092

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040092 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

150 

Antigen sequence

ALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQEDLVGL
LEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLT
GNIREFLPIVGHVQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVGC
 

Matching transcripts

HYI-001 - ENSP00000361507 [100%]
HYI-009 - ENSP00000428399 [100%]
HYI-201 - ENSP00000361502 [100%]
HYI-203 - ENSP00000461969 [100%]
HYI-002 - ENSP00000361509 [99%]
HYI-004 - ENSP00000361511 [96%]
HYI-005 - ENSP00000361510 [96%]
HYI-202 - ENSP00000361503 [96%]
HYI-006 - ENSP00000428501 [93%]
HYI-008 - ENSP00000428803 [93%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells an moderate staining in islets cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:600 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:172 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

33.0, 30.4, 30.3, 26.9, 26.1, 25.2, 23.0, 22.6, 20.6, 17.6 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
HYI-001
 
HYI-002
 
HYI-004
 
HYI-005
 
HYI-006
 
HYI-008
 
HYI-009
 
HYI-201
 
HYI-202
 
HYI-203