AURKB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037708

 

Antibody CAB005862

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA037708 ab3609 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

66  

Antigen sequence

WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVME
NSSGTPDILTRHFTID
 
 

Matching transcripts

AURKB-001 - ENSP00000463999 [100%]
AURKB-005 - ENSP00000462207 [100%]
AURKB-008 - ENSP00000462930 [100%]
AURKB-013 - ENSP00000461981 [100%]
AURKB-002 - ENSP00000313950 [99%]
AURKB-201 - ENSP00000445866 [99%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in a subset of urothelial cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:35 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

39.5, 39.3, 35.3, 26.2, 16.2, 13.5 39.5, 39.3, 35.3, 34.8, 28.0, 26.8, 26.2, 20.0, 16.2, 13.5, 7.8 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoskeleton (cytokinetic bridge).
More information
  

Antibody dilution

1:52  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AURKB-001
 
AURKB-002
 
AURKB-005
 
AURKB-008
 
AURKB-013
 
AURKB-201