PUF60

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045733

 

Antibody HPA052096

 

Antibody HPA059714

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA045733 HPA052096 HPA059714 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 14 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

93 83 82 

Antigen sequence

IKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQRALAIM
CRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKG
 
AATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAP
GVITGVTPARPPIPVTIPSVGVVNPILASPPTL
 
PIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPT
TGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGG
 

Matching transcripts

PUF60-001 - ENSP00000434359 [100%]
PUF60-003 - ENSP00000402953 [100%]
PUF60-005 - ENSP00000395417 [100%]
PUF60-011 - ENSP00000433403 [100%]
PUF60-025 - ENSP00000436131 [100%]
PUF60-002 - ENSP00000322036 [82%]
PUF60-004 - ENSP00000322016 [82%]
PUF60-006 - ENSP00000431960 [82%]
PUF60-012 - ENSP00000434863 [82%]
PUF60-013 - ENSP00000437309 [82%]
PUF60-024 - ENSP00000432610 [82%]
 PUF60-001 - ENSP00000434359 [100%]
PUF60-002 - ENSP00000322036 [100%]
PUF60-003 - ENSP00000402953 [100%]
PUF60-004 - ENSP00000322016 [100%]
PUF60-005 - ENSP00000395417 [100%]
PUF60-006 - ENSP00000431960 [100%]
PUF60-023 - ENSP00000432091 [92%]
 PUF60-001 - ENSP00000434359 [100%]
PUF60-002 - ENSP00000322036 [100%]
PUF60-003 - ENSP00000402953 [100%]
PUF60-004 - ENSP00000322016 [100%]
PUF60-005 - ENSP00000395417 [100%]
PUF60-006 - ENSP00000431960 [100%]
PUF60-024 - ENSP00000432610 [100%]
PUF60-025 - ENSP00000436131 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:750 1:350 

Literature conformity

 Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

 Consistent with RNA expression data Consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:22  1:62 

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

59.9, 58.2, 57.1, 55.7, 55.4, 54.0, 35.7, 34.5, 28.7, 26.9, 24.8 59.9, 58.2, 57.1, 55.7, 55.4, 54.0, 28.1 59.9, 58.2, 57.1, 55.7, 55.4, 54.0, 35.7, 34.5 

Antibody dilution

1:250 1:400 1:210 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3250 1:2500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
PUF60-001
 
PUF60-002
 
PUF60-003
 
PUF60-004
 
PUF60-005
 
PUF60-006
 
PUF60-011
 
PUF60-012
 
PUF60-013
 
PUF60-023
 
PUF60-024
 
PUF60-025
 
 »