PUF60

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045733

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA045733 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

93 

Antigen sequence

IKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQRALAIM
CRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKG
 

Matching transcripts

PUF60-001 - ENSP00000434359 [100%]
PUF60-003 - ENSP00000402953 [100%]
PUF60-005 - ENSP00000395417 [100%]
PUF60-011 - ENSP00000433403 [100%]
PUF60-025 - ENSP00000436131 [100%]
PUF60-002 - ENSP00000322036 [82%]
PUF60-004 - ENSP00000322016 [82%]
PUF60-006 - ENSP00000431960 [82%]
PUF60-012 - ENSP00000434863 [82%]
PUF60-013 - ENSP00000437309 [82%]
PUF60-024 - ENSP00000432610 [82%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

59.9, 58.2, 57.1, 55.7, 55.4, 54.0, 35.7, 34.5, 28.7, 26.9, 24.8 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
PUF60-001
 
PUF60-002
 
PUF60-003
 
PUF60-004
 
PUF60-005
 
PUF60-006
 
PUF60-011
 
PUF60-012
 
PUF60-013
 
PUF60-024
 
PUF60-025
 
 »