F2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051476

 

Antibody HPA054698

 

Antibody CAB016780

 

Antibody CAB018650

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 BioPorto Diagnostics A/S
 Santa Cruz Biotechnology
 

Product name

HPA051476 HPA054698 HYB 109-03 sc-33769 

Host species

Rabbit Rabbit Mouse Rabbit 

Clonality

pAb pAb mAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

12 12 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein Recombinant protein 

Length (aa)

83 79   

Antigen sequence

FEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQ
 
EGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSE
YQTFFNPRTFGSGEADCGLRPLFEKKSLE
 
 
 

Matching transcripts

F2-001 - ENSP00000308541 [100%]
F2-003 - ENSP00000387413 [100%]
F2-005 - ENSP00000433907 [100%]
 F2-001 - ENSP00000308541 [100%]
F2-005 - ENSP00000433907 [100%]
F2-003 - ENSP00000387413 [82%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in fraction of hepatocytes.
More information
 Immunohistochemical staining of human kidney shows distinct extracellular positivity.
More information
 Immunohistochemical staining of human vulva/anal skin shows distinct positivity in plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:550 1:400 1:100 1:150 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

70.0, 65.4, 35.9 70.0, 65.4, 35.9 70.0, 65.4, 35.9 70.0, 65.4, 35.9 

Antibody dilution

1:820 1:300 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:6550 1:2150   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
F2-001
 
F2-003
 
F2-005