SCRIB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023557

 

Antibody CAB015463

 

Antibody CAB022081

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Upstate
 

Product name

HPA023557 sc-55543 07-643  

Host species

Rabbit Mouse Rabbit 

Clonality

pAb mAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

11 11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

88   

Antigen sequence

VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSE
ACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS
 
 
 

Matching transcripts

SCRIB-001 - ENSP00000322938 [100%]
SCRIB-002 - ENSP00000349486 [100%]
SCRIB-003 - ENSP00000366756 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells found in seminiferus ducts.
More information
 Immunohistochemical staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human urinary bladder shows cytoplasmic and membranous positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1500 1:25 1:450 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

177.7, 174.9, 165.2 177.7, 174.9, 165.2, 68.3, 14.9 177.7, 174.9, 165.2, 68.3, 14.9 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
SCRIB-001
 
SCRIB-002
 
SCRIB-003