CLDN7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014703

 

Antibody CAB013063

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Zymed
 

Product name

HPA014703 18-7391 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

47  

Antigen sequence

PQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALS
 
 

Matching transcripts

CLDN7-001 - ENSP00000353475 [100%]
CLDN7-003 - ENSP00000396638 [100%]
CLDN7-004 - ENSP00000467220 [100%]
CLDN7-006 - ENSP00000460796 [100%]
CLDN7-201 - ENSP00000445131 [100%]
CLDN7-008 - ENSP00000465963 [81%]
  

Other gene match

RP1-4G17.5 - ENSG00000262302 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:100 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY420015)
More information
  

Target mass (kDa)

22.4, 20.7, 15.2, 15.1, 13.6, 8.8 22.4, 20.7, 15.2, 15.1, 13.6, 10.5 

Antibody dilution

1:125 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CLDN7-001
 
CLDN7-003
 
CLDN7-004
 
CLDN7-006
 
CLDN7-008
 
CLDN7-201